PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00004798-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 351aa    MW: 40008.4 Da    PI: 6.6189
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00004798-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.87.6e-083003332154
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            k +yp++e++++L +++gL+ +q+ +WF N+R +
  SMil_00004798-RA_Salv 300 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 333
                            469*****************************87 PP

2ELK22.23.4e-08254275122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+L++ Y+++++++++E++
  SMil_00004798-RA_Salv 254 ELKHELKQDYKEKIVDIREEIL 275
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.9E-2088132IPR005540KNOX1
PfamPF037901.2E-1790131IPR005540KNOX1
SMARTSM012561.1E-24142197IPR005541KNOX2
PfamPF037912.4E-18146196IPR005541KNOX2
PfamPF037891.6E-4254275IPR005539ELK domain
PROSITE profilePS512139.865254274IPR005539ELK domain
SMARTSM011880.0049254275IPR005539ELK domain
PROSITE profilePS5007111.726274337IPR001356Homeobox domain
SuperFamilySSF466892.52E-16276340IPR009057Homeodomain-like
SMARTSM003892.4E-11276341IPR001356Homeobox domain
CDDcd000863.28E-11277336No hitNo description
Gene3DG3DSA:1.10.10.602.2E-25281338IPR009057Homeodomain-like
PfamPF059209.2E-18294333IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MPLHHPHYSD HHHHHPSVFR SILPDHPDDK PPTSTWLNTS SLHHQWLPTQ SQPSPPTPTA  60
NSDHLQDSGD KSNGSGTNTN TNTNWEREKC KADILTHPLY EQLLSAHVSC LRIATPVDQL  120
PRIDAQLAQS QQVVAKYSVL GHAHHPLDDK DLDNFMTHYV LLLSSFKEQL QQHVRVHAME  180
AVMACWELEQ SLQSLTGVAP GEGSGATMSD DDEDQADSET NLFDESLDGG DNMGFGPLVP  240
SETERSLMER VRQELKHELK QDYKEKIVDI REEILRKRRA GKLPGDTTSV LKAWWQSHSK  300
WPYPTEEDKA RLVQETGLQL KQINNWFINQ RKRNWHSNPS SSSTPKSKRK R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12277342873Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330350RKRNWHSNPSSSSTPKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084051.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X3
RefseqXP_011084050.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X2
RefseqXP_011084049.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotO223001e-165LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLA0A022QCD30.0A0A022QCD3_ERYGU; Uncharacterized protein
STRINGVIT_11s0118g00800.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-156KNOTTED1-like homeobox gene 3